Sale!

stellachewysdoggourmetpateduckchickenrecipestellachewysitsagreatpricefortheyourmoney0.png

stellachewysdoggourmetpateduckchickenrecipestellachewysitsagreatpricefortheyourmoney1.png

Stella & Chewy’s Dog Gourmet Pâté Duck & Chicken Recipe Stella & Chewy’s

Name: Stella & Chewy's Dog Gourmet Pâté Duck & Chicken Recipe Stella & Chewy's It's a great price for the your money
SKU: mode_7215158657124
Price: 2.69 USD
Availability: InStock

Original price was: $ 4,49.Current price is: $ 2,69.

Title

Clear

SKU: mode_7215158657124 Category: Uncategorized Tags: Brand_Stella & Chewy's, Category_Dog, Dog, Endless Aisles, NMR, Stella & Chewy's, Subcategory_Wet Food, Wet Food

At Stella & Chewy’s we believe in feeding our pets wholesome, nutritious, protein-rich meals to help them thrive. This savory gourmet pâté combines a creamy mix of cage-free duck and chicken liver with chunks of chicken breast. The texture and taste have been carefully crafted to make mealtime special while providing a boost of healthy protein.

Dual texture: creamy, smooth paté packed with chunks of chicken breast
#1 ingredient cage-free duck
95% protein from animal sources
Boosted with vitamins and minerals for a complete & balanced meal or tasty topper
Rich in protein for a taste dogs crave
For dogs of all breed sizes
Easy open lid
Made Without: Grains, Legumes, By-Product Meals, Artificial Colors, Flavors or Preservatives

Ingredients:

Duck, Chicken, Duck Broth, Chicken Broth, Tapioca, Chicken Liver, Dried Egg, Sunflower Oil, Salt, Potassium Chloride, Minerals (Zinc Oxide, Reduced Iron, Sodium Selenite, Manganese Sulfate, Copper Amino Acid Complex, Potassium Iodide), Sodium Phosphate, Vitamins (Vitamin E Supplement, Vitamin A Supplement, Niacin Supplement, d-Calcium Pantothenate, Thiamine Mononitrate, Beta-Carotene, Biotin, Vitamin D3 Supplement, Riboflavin Supplement, Vitamin B12 Supplement, Pyridoxine Hydrochloride, Folic Acid), Choline Chloride, Magnesium Sulfate, Celery Powder, Calcium Sulfate.

Guaranteed Analysis:

Crude Protein 10% (min), Crude Fat 5% (min), Crude Fiber 2% (max), Moisture 78% (max)

Title	12.5 Oz Single

Fast shipping and professional packing

Due to our long-term partnership in a long-standing partnership with UPS, FedEx, DHL and many other world-class carriers, we can offer various shipping options. Our warehouse staff are highly skilled and will pack your products according to our precise and exact specifications. Prior to shipping, your goods are thoroughly inspected and secured. We ship to thousands clients every day from all over the world. Our dedication to becoming the biggest online retailer in the world is shown by this. Warehouses and distribution centres can be located throughout Europe and the USA.

Note that orders containing multiple items are processed according to the specific item.

Prior to shipment Our team will conduct an extensive inspection of the products you have ordered. The majority of orders are shipped within 48 hours. Delivery is expected to take between three and seven days.

Returns

Due to multiple parties such as the factory and the warehouse, we're unable to effectively manage inventory. Stocks can be changed at any time. Be aware that your order will be unable to fill after you place the order.

Our policy lasts for thirty days. If you don't receive the product within the 30 days period, we're not able to issue either a return or exchange.

To be returned the item must not be opened and in the same condition as when you received it in. The item must be in the original packaging.

Stella & Chewy’s Dog Gourmet Pâté Duck & Chicken Recipe Stella & Chewy’s

Related products

Login