Sale!

checkoutourcollectiontofindthehillssciencedietadultperfectweightsmallminichickenrecipedogfood125lbhillspetnutritionyouwantatareasonableprice0.jpg

Hill’s Science Diet Adult Perfect Weight Small & Mini Chicken Recipe Dog Food (12.5 LB) Hill’s Pet Nutrition

Name: Check out our collection to find the Hill's Science Diet Adult Perfect Weight Small & Mini Chicken Recipe Dog Food (12.5 LB) Hill's Pet Nutrition you want at a reasonable price
SKU: mode_7377176756324
Price: 27.50 USD
Availability: InStock

Original price was: $ 54,99.Current price is: $ 27,50.

Title

Clear

SKU: mode_7377176756324 Category: Uncategorized Tags: Brand_Hill's Pet Nutrition, Category_Dog, Dog, Dry Food, Hill's Pet Nutrition, NMR, Pet, Subcategory_Dry Food

Hill’s Science Diet Perfect Weight Small & Mini dry dog food provides delicious, breakthrough weight management nutrition with clinically proven technology for:

Safe & effective weight loss with visible results within 10 weeks
Healthy weight maintenance & long lasting weight support
Lean muscle support

Additional info:

At Hill’s, we have been studying how nutrition impacts pets’ cell function for over a decade. We learned that lean pets have a different biology than overweight pets. Our high protein, high fiber formula enriched with L-carnitine & coconut oil helps support pets’ metabolisms for a healthy body weight.

Recommended for:

Adult dogs, including those that are less active, neutered or otherwise prone to weight gain

Not recommended for:

Puppies and pregnant or nursing dogs. During pregnancy or nursing, dogs should be switched to Hill’s Science Diet Puppy, Hill’s Science Diet Puppy Small Bites or Hill’s Science Diet Puppy Small Paws dry dog food.

INGREDIENTS:

Chicken, Cracked Pearled Barley, Brown Rice, Pea Fiber, Corn Gluten Meal, Chicken Meal, Dried Tomato Pomace, Oat Fiber, Carrots, Chicken Liver Flavor, Flaxseed, Dried Beet Pulp, Coconut Oil, Pork Liver Flavor, Lactic Acid, Potassium Chloride, L-Lysine, DL-Methionine, Iodized Salt, Lipoic Acid, vitamins (Vitamin E Supplement, L-Ascorbyl-2-Polyphosphate (source of Vitamin C), Niacin Supplement, Thiamine Mononitrate, Vitamin A Supplement, Calcium Pantothenate, Riboflavin Supplement, Biotin, Vitamin B12 Supplement, Pyridoxine Hydrochloride, Folic Acid, Vitamin D3 Supplement), Choline Chloride, minerals (Manganese Sulfate, Ferrous Sulfate, Zinc Oxide, Copper Sulfate, Calcium Iodate, Sodium Selenite), Taurine, Mixed Tocopherols for freshness, Natural Flavors, L-Carnitine, Beta-Carotene, Apples, Broccoli, Cranberries, Green Peas.

FEEDING GUIDE

HELPFUL TIPS

Adjust feeding amounts as necessary to maintain optimal weight. If you are unsure, ask your veterinarian.
New to this food? Mix increasing amounts of your pet’s new food with decreasing amounts of the old food over a 7-day period.
Keep fresh water available at all times!
Your pets nutritional needs may change as they age. Ask your vet at every checkup.
To prevent suffocation, keep the packaging out of the reach of pets and children.

Weight Control

Ideal Weight of Dog — lbs (kgs)	Amount per Day – cups (grams) – Weight loss	Amount per Day – cups (grams) – Adult maintenance
2 (0,9)	1/4 (25)	3/8 (35)
5 (2,3)	1/2 (45)	3/4 (70)
8 (3,6)	5/8 (55)	1 (90)
10 (4,5)	3/4 (70)	1 1/4 (115)
15 (6,8)	1 (90)	1 5/8 (145)
20 (9,1)	1 1/4 (115)	2 (180)
25 (11,3)	1 1/2 (135)	2 1/3 (210)

Animal feeding tests using AAFCO procedures substantiate that Hill’s Science Diet Adult Perfect Weight Small & Mini Dog Food provides complete and balanced nutrition for maintenance of adult dogs.

AVERAGE NUTRIENT & CALORIC CONTENT

3191 kcal/kg (289 kcal/cup†)

Nutrient	Dry Matter¹ %
Protein	28.6 %
Fat	11.2 %
Carbohydrate / NFE	43.3 %
Crude Fiber	10.4 %
Calcium	0.93 %
Phosphorus	0.74 %
Potassium	0.99 %
Sodium	0.38 %
Magnesium	0.142 %
Vitamin C	231 ppm
Vitamin E	1331 IU/kg
>20C Omega-3 FA	0.01 %
>20C Omega-6 FA	0.11 %
Carnitine	430.2 ppm
Glucosamine	602 ppm
Chondroitin Sulfate	1351 ppm

References

1The nutrient in the product after moisture is removed. It is used to make direct comparisons of nutrient profiles with differing moisture contents.

Title	12.5 LB

Fast shipping and professional packing

Due to our long-term partnership in a long-standing partnership with UPS, FedEx, DHL and many other world-class carriers, we can offer various shipping options. Our warehouse staff are highly skilled and will pack your products according to our precise and exact specifications. Prior to shipping, your goods are thoroughly inspected and secured. We ship to thousands clients every day from all over the world. Our dedication to becoming the biggest online retailer in the world is shown by this. Warehouses and distribution centres can be located throughout Europe and the USA.

Note that orders containing multiple items are processed according to the specific item.

Prior to shipment Our team will conduct an extensive inspection of the products you have ordered. The majority of orders are shipped within 48 hours. Delivery is expected to take between three and seven days.

Returns

Due to multiple parties such as the factory and the warehouse, we're unable to effectively manage inventory. Stocks can be changed at any time. Be aware that your order will be unable to fill after you place the order.

Our policy lasts for thirty days. If you don't receive the product within the 30 days period, we're not able to issue either a return or exchange.

To be returned the item must not be opened and in the same condition as when you received it in. The item must be in the original packaging.

Hill’s Science Diet Adult Perfect Weight Small & Mini Chicken Recipe Dog Food (12.5 LB) Hill’s Pet Nutrition

Additional info:

Recommended for:

Not recommended for:

Weight Control

Related products

Login