Sale!

weareproudoftakingcareofeverycustomerweserveasiftheyarefamilymembershelpingcustomerslocatethehillsbioactiverecipeadultfitradiantdogfoodhillspetnutrition0.jpg

Hill’s® Bioactive Recipe Adult Fit + Radiant dog food Hill’s Pet Nutrition

Name: We are proud of taking care of every customer we serve as if they are family members. Helping customers locate the Hill's® Bioactive Recipe Adult Fit + Radiant dog food Hill's Pet Nutrition
SKU: mode_6592916455524
Price: 10.19 USD
Availability: InStock

Original price was: $ 16,99.Current price is: $ 10,19.

Title

Clear

SKU: mode_6592916455524 Category: Uncategorized Tags: Brand_Hill's Pet Nutrition, Category_Dog, Dog, Dry Food, Hill's Pet Nutrition, NMR, Pet, Subcategory_Dry Food

Hill’s^® Bioactive Recipe Fit + Radiant contains a synergistic blend that includes Rich Protein, Coconut Oil and Carrots

Chicken #1 Ingredient
No Corn, Wheat, or Soy
Not artificially preserved, colored or flavored

Key ingredients to:

Help skin and coat look beautiful
Activate a healthy metabolism for natural playfulness

Recommended for:

Adult dogs

Not recommended for:

Puppies, pregnant or nursing dogs.

During pregnancy or nursing, dogs should be switched to: Hill’s^® Bioactive Recipe Grow + Learn Puppy Dry Food

INGREDIENTS: Chicken, Cracked Pearled Barley, Pea Protein, Brown Rice, Dried Beet Pulp, Dried Tomato Pomace, Pea Fiber, Powdered Cellulose, Brewers Rice, Chicken Meal, Chicken Liver Flavor, Flaxseed, Coconut Oil, Lactic Acid, Potassium Chloride, DL-Methionine, Carrots, Calcium Carbonate, Iodized Salt, Green Peas, Choline Chloride, Apples, Cranberries, vitamins (Vitamin E Supplement, L-Ascorbyl-2-Polyphosphate (source of Vitamin C), Niacin Supplement, Thiamine Mononitrate, Vitamin A Supplement, Calcium Pantothenate, Vitamin B12 Supplement, Pyridoxine Hydrochloride, Riboflavin Supplement, Biotin, Folic Acid, Vitamin D3 Supplement), minerals (Ferrous Sulfate, Zinc Oxide, Copper Sulfate, Manganous Oxide, Calcium Iodate, Sodium Selenite), Taurine, Broccoli, Mixed Tocopherols for freshness, L-Carnitine, Natural Flavors, Beta-Carotene.

Adult maintenance

Weight of Dog – lbs (kgs)	Amount per Day – cups(grams)
5 (2,3)	3/4 (70)
10 (4,5)	1 1/4 (115)
20 (9,1)	2 (180)
30 (14)	2 3/4 (250)
40 (18)	3 1/2 (320)
50 (23)	4 (365)
60 (27)	4 2/3 (425)
80 (36)	5 3/4 (525)
100 (45)	6 3/4 (615)
120 (54)	7 3/4 (705)

Hill’s® Bioactive Recipe Adult Fit + Radiant dog food is formulated to meet the nutritional levels established by the AAFCO Dog Food Nutrient Profiles for maintenance of adult dogs.

We care about the health of your pet. Visit your veterinarian regularly and ask if nutritional needs have changed. Adjust feeding amounts as needed to maintain optimal body weight.

HELPFUL TIPS

New food? Please transition your pet.
Keep fresh water available at all times.
Hill’s Bioactive Recipe is available in dry foods and wet foods.

3153 kcal/kg (286 kcal/cup†)

Nutrient	Dry Matter¹ %
Protein	28.7
Fat	10.8
Carbohydrate / NFE	43.1
Crude Fiber	11.0
Calcium	0.88
Phosphorous	0.68
Potassium	0.86
Sodium	0.34
Magnesium	0.147
Vitamin C	111 ppm
Vitamin E	582 IU/kg
Total Omega-3 FA	0.80
Total Omega-6 FA	2.33

Title	3.5 oz, 11 lb

Fast shipping and professional packing

Due to our long-term partnership in a long-standing partnership with UPS, FedEx, DHL and many other world-class carriers, we can offer various shipping options. Our warehouse staff are highly skilled and will pack your products according to our precise and exact specifications. Prior to shipping, your goods are thoroughly inspected and secured. We ship to thousands clients every day from all over the world. Our dedication to becoming the biggest online retailer in the world is shown by this. Warehouses and distribution centres can be located throughout Europe and the USA.

Note that orders containing multiple items are processed according to the specific item.

Prior to shipment Our team will conduct an extensive inspection of the products you have ordered. The majority of orders are shipped within 48 hours. Delivery is expected to take between three and seven days.

Returns

Due to multiple parties such as the factory and the warehouse, we're unable to effectively manage inventory. Stocks can be changed at any time. Be aware that your order will be unable to fill after you place the order.

Our policy lasts for thirty days. If you don't receive the product within the 30 days period, we're not able to issue either a return or exchange.

To be returned the item must not be opened and in the same condition as when you received it in. The item must be in the original packaging.

Hill’s® Bioactive Recipe Adult Fit + Radiant dog food Hill’s Pet Nutrition

Recommended for:

Not recommended for:

Adult maintenance

Related products

Login